PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G04840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 443aa    MW: 50009.9 Da    PI: 6.2336
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G04840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-17142188148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd +lv++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
  OMERI06G04840.1 142 KGQWTLEEDRKLVKLVEQFGLRKWSHIAQILP-GRVGKQCRERWHNHL 188
                      799*****************************.*************97 PP

2Myb_DNA-binding51.72.1e-16194236145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  OMERI06G04840.1 194 KDTWSEEEDIVLIQTHKEVGNK-WAEIAKHLP-GRTENSIKNHWN 236
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.59137192IPR017930Myb domain
SuperFamilySSF466899.71E-32139235IPR009057Homeodomain-like
SMARTSM007171.6E-15141190IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-27143195IPR009057Homeodomain-like
PfamPF139214.5E-20145204No hitNo description
CDDcd001671.54E-15145188No hitNo description
PROSITE profilePS5129421.249193243IPR017930Myb domain
SMARTSM007171.3E-15193241IPR001005SANT/Myb domain
CDDcd001671.28E-12196239No hitNo description
Gene3DG3DSA:1.10.10.605.3E-22196241IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MDFSCFQPHS GGCDDMPFDS YVQQNGHQEF HLVDHSFNNV TDDHEYYSPS AGGSFLPFAT  60
YYDLGHEYYP QGGEKDAVVV DRASPTIRKA SPHLPLFTPK SEVSHLIGGG VVGSYKAFEM  120
NSKLIRRKRA SGKSLKKANV VKGQWTLEED RKLVKLVEQF GLRKWSHIAQ ILPGRVGKQC  180
RERWHNHLRP NIKKDTWSEE EDIVLIQTHK EVGNKWAEIA KHLPGRTENS IKNHWNATKR  240
RQFARRRSRA SSKNPKSGTL LQNYIKSLGI GPIKSSVRQA PPESTAVSSS SPASTQKLAE  300
VNGKIRPDSN PSNQMVTQGI LTMDENSYIQ TNSCEELLVS TYDDLCLDMC DHLFETKDET  360
PYQVYNIDDD VDMNYIFNHI DYANKIGHEI DMEMAWDDDV LQDDESAGSS PLETLAGLAQ  420
INTVHVKEEM DLIEMVTSTQ SCG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C4e-451402422104C-Myb DNA-Binding Domain
1mse_C4e-451402422104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2418120.0AK241812.1 Oryza sativa Japonica Group cDNA, clone: J065210K15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641269.10.0PREDICTED: myb-related protein A isoform X1
TrEMBLA0A0E0DXE10.0A0A0E0DXE1_9ORYZ; Uncharacterized protein
STRINGBGIOSGA022369-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-64myb domain protein 98